HORDB

ID: hor006738
Uniprot ID: P53542
Protein name: Glycoprotein hormones alpha chain
Gene name: cga
Organism: Clarias gariepinus (North African catfish) (Silurus gariepinus)
Family: Glycoprotein hormones subunit alpha family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Clarias (genus), Clariidae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity; GO:0046982 protein heterodimerization activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence: YPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVIVNDVKLVNHTDCHCSTCYYHKF
Length: 92
Propeptide: MTLIPKYTGATILLLCVLIEIGQLYPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVIVNDVKLVNHTDCHCSTCYYHKF
Signal peptide: MTLIPKYTGATILLLCVLIEIGQL
Modification: NA
Glycosylation: T53 N-linked (GlcNAc...) asparagine;T78 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Involved in gametogenesis and steroidogenesis.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006738_AF2.pdb

hor006738_ESM.pdb

Mass:	1208450	Formula:	C456H715N125O133S12
Absent amino acids:	W	Common amino acids:	CK
pI:	8.41	Basic residues:	16
Polar residues:	36	Hydrophobic residues:	23
Hydrophobicity:	-37.07	Boman Index:	-15335
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	59.24
Instability Index:	5351.2	Extinction Coefficient cystines:	8075
Absorbance 280nm:	88.74